cleavage stimulation factor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25770725UL

Catalog No. NB393819

Description

cleavage stimulation factor Polyclonal specifically detects cleavage stimulation factor in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: cleavage stimulation factor
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit, cleavage stimulation factor subunit 1, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa, CSTF 50 kDa subunit, CstF-50, CstFp50
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CSTF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 1477
• Target Species: Human
• Isotype: IgG

For Research Use Only