Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLEC10A/CD301 Antibody, Novus Biologicals™
SDP

Catalog No. NB432532 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432532 25 μL
NBP184591 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432532 Supplier Novus Biologicals Supplier No. NBP18459125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CLEC10A/CD301 Polyclonal specifically detects CLEC10A/CD301 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CLEC10A/CD301
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8IUN9
Gene Alias CD301 antigen, CD301C-type lectin domain family 10 member A, CLECSF13, CLECSF14macrophage C-type lectin, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 14 (macrophage-derived), C-type lectin domain family 10, member A, C-type lectin superfamily member 14, HML2, HMLC-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 13 (macrophage-derived), Macrophage lectin 2, macrophage lectin 2 (calcium dependent), MGL
Gene Symbols CLEC10A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWND
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 10462
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.