CLEC3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230595

Catalog No. NBP230595

Description

CLEC3A Polyclonal specifically detects CLEC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CLEC3A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunofluorescence
• Gene Accession No.: O75596
• Gene Symbols: CLEC3A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Cartilage-derived C-type lectin, CLECSF1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived), C-type lectin domain family 3 member A, C-type lectin domain family 3, member A, C-type lectin superfamily member 1, C-type lectin, superfamily member 1, MGC129558, MGC129559
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10143
• Target Species: Human
• Isotype: IgG

For Research Use Only