CLEC3B/Tetranectin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23822225UL

Catalog No. NB396928

Description

CLEC3B/Tetranectin Polyclonal specifically detects CLEC3B/Tetranectin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CLEC3B/Tetranectin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P05452
• Gene Symbols: CLEC3B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 7123
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C-type lectin domain family 3 member B, C-type lectin domain family 3, member B, DKFZp686H17246, Plasminogen kringle 4-binding protein, tetranectin (plasminogen binding protein), TNAtetranectin (plasminogen-binding protein), TNtetranectin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.