Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLN6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15964620UL
Description
CLN6 Polyclonal specifically detects CLN6 in Human samples. It is validated for Western Blot.Specifications
CLN6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NWW5 | |
CLN6 | |
Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the middle region of CLN6. Peptide sequence LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL. | |
Affinity Purified | |
RUO | |
54982 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ceroid-lipofuscinosis neuronal protein 6, ceroid-lipofuscinosis, neuronal 6, late infantile, variant, FLJ20561, HsT18960, nclf, Protein CLN6 | |
Rabbit | |
36 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction