CLNS1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233964

Catalog No. NBP233964

Description

CLNS1A Polyclonal specifically detects CLNS1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CLNS1A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P54105
• Gene Symbols: CLNS1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 1207
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, ClCI, CLNS1B, I(Cln), ICln, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only