Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CMC2 Antibody, Novus Biologicals™

CMC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15656720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15656720 20 μL
NBP156567 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15656720 Supplier Novus Biologicals Supplier No. NBP15656720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

CMC2 Polyclonal specifically detects CMC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen CMC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NRP2
Gene Alias 2310061C15Rik, C16orf61, chromosome 16 open reading frame 61, COX assembly mitochondrial protein 2 homolog (S. cerevisiae), DC13, hypothetical protein LOC56942
Gene Symbols CMC2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C16ORF61 The peptide sequence was selected from the middle region of C16orf61. Peptide sequence NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56942
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.