CNIH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168915

Catalog No. NBP168915

Description

CNIH Polyclonal specifically detects CNIH in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CNIH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CNIH1, CNILMGC117156, cornichon homolog (Drosophila), T-cell growth-associated molecule 77, TGAM77protein cornichon homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 15 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B0BNA6
• Gene Symbols: CNIH1
• Immunogen: Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10175
• Target Species: Mouse, Rat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG