Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNIH Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CNIH |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168915
|
Novus Biologicals
NBP168915 |
100 μL |
Each of 1 for $436.00
|
|
Description
CNIH Polyclonal specifically detects CNIH in Rat samples. It is validated for Western Blot.Specifications
CNIH | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CNIH1, CNILMGC117156, cornichon homolog (Drosophila), T-cell growth-associated molecule 77, TGAM77protein cornichon homolog | |
Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
B0BNA6 | |
10175 | |
IgG | |
Affinity Purified | |
15 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title