Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNIH Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | CNIH |
|---|---|
| Immunogen | Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16891520 |
Novus Biologicals
NBP16891520UL |
20ul |
Each for $149.00
|
|
NBP168915 |
Novus Biologicals
NBP168915 |
100 ul |
Each for $329.00
|
|
Description
CNIH Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.Specifications
| CNIH | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 10175 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL. | |
| Primary | |
| IgG | |
| CNIH1, CNILMGC117156, cornichon homolog (Drosophila), T-cell growth-associated molecule 77, TGAM77protein cornichon homolog | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title