Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CNNM2 Antibody, Novus Biologicals™

CNNM2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17050220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17050220 20 μL
NBP170502 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17050220 Supplier Novus Biologicals Supplier No. NBP17050220UL

Description

Rabbit Polyclonal Antibody

CNNM2 Polyclonal specifically detects CNNM2 in Human samples. It is validated for Western Blot.

Specifications

Antigen CNNM2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias cyclin M2, metal transporter CNNM2
Gene Symbols CNNM2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CNNM2(cyclin M2) The peptide sequence was selected from the middle region of CNNM2. Peptide sequence EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL.
Molecular Weight of Antigen 96 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54805
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.