Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNNM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | CNNM2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17050220
![]() |
Novus Biologicals
NBP17050220UL |
20 μL |
Each for $158.00
|
|
|||||
NBP170502
![]() |
Novus Biologicals
NBP170502 |
100 μL |
Each for $487.50
|
|
|||||
Description
CNNM2 Polyclonal specifically detects CNNM2 in Human samples. It is validated for Western Blot.Specifications
CNNM2 | |
Polyclonal | |
Rabbit | |
cyclin M2, metal transporter CNNM2 | |
CNNM2 | |
IgG | |
96 kDa |
Western Blot | |
Unconjugated | |
RUO | |
54805 | |
Synthetic peptides corresponding to CNNM2(cyclin M2) The peptide sequence was selected from the middle region of CNNM2. Peptide sequence EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title