CNOT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23204525UL

Catalog No. NB397519

Description

CNOT1 Polyclonal specifically detects CNOT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CNOT1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: A5YKK6
• Gene Symbols: CNOT1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AD-005, adrenal gland protein AD-005, CCR4-associated factor 1, CCR4-NOT transcription complex subunit 1, CCR4-NOT transcription complex, subunit 1, CDC39DKFZp686E0722, hNOT1, KIAA1007DKFZp686O168, Negative regulator of transcription subunit 1 homolog, NOT1 (negative regulator of transcription 1, yeast) homolog, NOT1FLJ90644, NOT1HFLJ36492
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23019
• Target Species: Human
• Isotype: IgG

For Research Use Only