Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CNPase Antibody (CL2871), Novus Biologicals™
SDP

Catalog No. NB396380 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396380 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396380 Supplier Novus Biologicals Supplier No. NBP24663525UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

CNPase Monoclonal antibody specifically detects CNPase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen CNPase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL2871
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Knockdown Validated
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P09543
Gene Alias 2', 3' cyclic nucleotide 3' phosphohydrolase, 2'-3'-cyclic nucleotide 3' phosphodiesterase, 2'-3'-cyclic-nucleotide 3'-phosphodiesterase, CNP1, CNPase, EC 3.1.4.37
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Glia Markers, Neuronal Cell Markers, Neuroscience, Oligodendrocyte Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1267
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.