Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CNTFR Antibody, Novus Biologicals™

CNTFR Antibody, Novus Biologicals™
SDP

Catalog No. NBP16894320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16894320 20 μL
NBP168943 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16894320 Supplier Novus Biologicals Supplier No. NBP16894320UL

Description

Rabbit Polyclonal Antibody

CNTFR Polyclonal specifically detects CNTFR in Human samples. It is validated for Western Blot.

Specifications

Antigen CNTFR
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P26992
Gene Alias ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774
Gene Symbols CNTFR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Molecular Weight of Antigen 41 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Growth and Development, Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1271
Test Specificity This product is specific to Subunit or Isoform: alpha.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.