Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CNTFR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	CNTFR
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16894320 View Documents View Product Certificates	Novus Biologicals NBP16894320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP168943 View Documents View Product Certificates	Novus Biologicals NBP168943	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CNTFR Polyclonal specifically detects CNTFR in Human samples. It is validated for Western Blot.

Specifications

Antigen	CNTFR
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Growth and Development, Neuronal Cell Markers
Gene Alias	ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774
Gene Symbols	CNTFR
Isotype	IgG
Test Specificity	This product is specific to Subunit or Isoform: alpha.

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P26992
Gene ID (Entrez)	1271
Immunogen	Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Primary or Secondary	Primary
Molecular Weight of Antigen	41 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CNTFR Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents