Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Coagulation Factor II/Thrombin Antibody, Novus Biologicals™

Coagulation Factor II/Thrombin Antibody, Novus Biologicals™
SDP

Catalog No. NBP17414220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17414220 20 μL
NBP174142 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17414220 Supplier Novus Biologicals Supplier No. NBP17414220UL

Description

Rabbit Polyclonal Antibody

Coagulation Factor II/Thrombin Polyclonal specifically detects Coagulation Factor II/Thrombin in Rat samples. It is validated for Western Blot.

Specifications

Antigen Prothrombin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P18292
Gene Alias Coagulation factor II, coagulation factor II (thrombin), EC 3.4.21, EC 3.4.21.5, prothrombin, prothrombin B-chain, PT, serine protease
Gene Symbols F2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of F2. Immunizing peptide sequence CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2147
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.