Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Coagulation Factor III/Tissue Factor Antibody (CL3807), Novus Biologicals™
SDP

Catalog No. NB403018 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403018 25 μL
NBP261641 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403018 Supplier Novus Biologicals Supplier No. NBP26164125UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Coagulation Factor III/Tissue Factor Monoclonal specifically detects Coagulation Factor III/Tissue Factor in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Coagulation Factor III/Tissue Factor
Applications Western Blot, Immunohistochemistry
Classification Monoclonal
Clone CL3807
Conjugate Unconjugated
Dilution Western Blot 1 μg/ml, Immunohistochemistry 1:2500 - 1:5000
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor
Gene Symbols F3
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2152
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.