Coatomer Subunit Delta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25523525UL

Catalog No. NB404003

Description

Coatomer Subunit Delta Polyclonal specifically detects Coatomer Subunit Delta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Coatomer Subunit Delta
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Archain, archain 1, archain vesicle transport protein 1, coatomer delta subunit, coatomer protein complex, subunit delta, coatomer protein delta-COP, coatomer subunit delta, COPD, Delta-coat protein, delta-COP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 372
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ARCN1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only