COCO/DAND5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21389925UL

Catalog No. NB438209

Description

COCO/DAND5 Polyclonal specifically detects COCO/DAND5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: COCO/DAND5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CER2CRL2, cerberus-like 2, Cerberus-like protein 2, cerl-2, CERL2, CKTSF1B3MGC126849, COCO, Cysteine knot superfamily 1, BMP antagonist 3, DAN domain family member 5, DAN domain family, member 5, DANTE, DTE, FLJ38607, GREM3cerberus 2, Gremlin-3, SP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 199699
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DAND5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only