Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | COG2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15314920
![]() |
Novus Biologicals
NBP15314920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP153149
![]() |
Novus Biologicals
NBP153149 |
100 μL |
Each for $487.50
|
|
|||||
Description
COG2 Polyclonal specifically detects COG2 in Human samples. It is validated for Western Blot.Specifications
COG2 | |
Polyclonal | |
Rabbit | |
Golgi Apparatus Markers | |
component of oligomeric golgi complex 2COG complex subunit 2, conserved oligomeric Golgi complex protein 2, conserved oligomeric Golgi complex subunit 2, LDLCbrefeldin A-sensitive, peripheral Golgi protein, low density lipoprotein receptor defect C complementing, Low density lipoprotein receptor defect C-complementing protein | |
COG2 | |
IgG | |
This product is specific to Subunit or Isoform: 2. |
Western Blot | |
Unconjugated | |
RUO | |
Q14746 | |
22796 | |
Synthetic peptides corresponding to COG2(component of oligomeric golgi complex 2) The peptide sequence was selected from the N terminal of COG2. Peptide sequence KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ. | |
Primary | |
83 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title