Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COG2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen COG2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15314920
View Documents
Novus Biologicals
NBP15314920UL
20 μL
Each for $152.22
Add to cart
 
NBP153149
View Documents
Novus Biologicals
NBP153149
100 μL
Each for $436.00
Add to cart
 
Description

Description

COG2 Polyclonal specifically detects COG2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

COG2
Polyclonal
Rabbit
Golgi Apparatus Markers
Q14746
22796
Synthetic peptides corresponding to COG2(component of oligomeric golgi complex 2) The peptide sequence was selected from the N terminal of COG2. Peptide sequence KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
83 kDa
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
component of oligomeric golgi complex 2COG complex subunit 2, conserved oligomeric Golgi complex protein 2, conserved oligomeric Golgi complex subunit 2, LDLCbrefeldin A-sensitive, peripheral Golgi protein, low density lipoprotein receptor defect C complementing, Low density lipoprotein receptor defect C-complementing protein
COG2
IgG
Affinity Purified
This product is specific to Subunit or Isoform: 2.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit