Learn More
Description
Specifications
Specifications
| Antigen | COG3 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | COG complex subunit 3, component of oligomeric golgi complex 3p94, SEC34conserved oligomeric Golgi complex subunit 3, tethering factor SEC34, Vesicle-docking protein SEC34 homolog |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
