COG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155199

Catalog No. NBP155199

Description

COG4 Polyclonal specifically detects COG4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COG4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519
• Host Species: Rabbit
• Molecular Weight of Antigen: 89 kDa
• Quantity: 100 μL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 25839
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H9E3
• Gene Symbols: COG4
• Immunogen: Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 4.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG