Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COG4 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155198

 View more versions of this product

Catalog No. NBP155198


Add to cart

Description

Description

COG4 Polyclonal antibody specifically detects COG4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

COG4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
COG4
Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ.
89 kDa
100 ul
Golgi Apparatus Markers
Primary
25839
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q9H9E3
CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: 4.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit