Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COL9A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16893720UL
Description
COL9A3 Polyclonal specifically detects COL9A3 in Human samples. It is validated for Western Blot.Specifications
COL9A3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q14050 | |
COL9A3 | |
Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP. | |
Affinity Purified | |
RUO | |
1299 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
collagen type IX proteoglycan, collagen, type IX, alpha 3, DJ885L7.4.1, EDM3collagen alpha-3(IX) chain, FLJ90759, IDDcollagen IX, alpha-3 polypeptide, MED | |
Rabbit | |
63 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction