Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. COL9A3 Antibody, Novus Biologicals™

COL9A3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16893720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16893720 20 μL
NBP168937 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16893720 Supplier Novus Biologicals Supplier No. NBP16893720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

COL9A3 Polyclonal specifically detects COL9A3 in Human samples. It is validated for Western Blot.

Specifications

Antigen COL9A3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q14050
Gene Alias collagen type IX proteoglycan, collagen, type IX, alpha 3, DJ885L7.4.1, EDM3collagen alpha-3(IX) chain, FLJ90759, IDDcollagen IX, alpha-3 polypeptide, MED
Gene Symbols COL9A3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP.
Molecular Weight of Antigen 63 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1299
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.