Collagen I alpha 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168942

Catalog No. NBP168942

Description

Collagen I alpha 1 Polyclonal specifically detects Collagen I alpha 1 in Human samples. It is validated for Western Blot, ELISA.

Specifications

• Antigen: Collagen I alpha 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain
• Host Species: Rabbit
• Molecular Weight of Antigen: 139 kDa
• Quantity: 100 μL
• Research Discipline: Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells
• Gene ID (Entrez): 1277
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, ELISA
• Gene Accession No.: P02452
• Gene Symbols: COL1A1
• Immunogen: This Collagen I alpha 1 antibody was raised against synthetic peptides corresponding to COL1A1 (collagen, type I, alpha 1) The peptide sequence was selected from the C terminal of COL1A1. Peptide sequence YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG