Collagen III alpha 1/COL3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184007

Catalog No. NBP184007

Description

Collagen III alpha 1/COL3A1 Polyclonal specifically detects Collagen III alpha 1/COL3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Collagen III alpha 1/COL3A1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P02461
• Gene Symbols: COL3A1
• Immunogen: This Collagen III alpha 1/COL3A1 Antibody was developed against a recombinant protein corresponding to amino acids: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alpha1 (III) collagen, Collagen 3, collagen alpha-1(III) chain, collagen, fetal, collagen, type III, alpha 1, Collagen-3, EDS4A, Ehlers-Danlos syndrome type IV, autosomal dominant, FLJ34534
• Host Species: Rabbit
• Molecular Weight of Antigen: 139 kDa
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Biology, Extracellular Matrix
• Gene ID (Entrez): 1281
• Target Species: Human
• Isotype: IgG

For Research Use Only