Learn More
Common gamma Chain/IL-2 R gamma Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Common gamma Chain/IL-2 R gamma |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CD132, CD132 antigen, CIDX, combined immunodeficiency, X-linked, common cytokine receptor gamma chain, common gamma-chain, cytokine receptor common subunit gamma, gamma(c), IL-2 receptor subunit gamma, IL-2R subunit gamma, IL-2RG, IMD4, interleukin 2 receptor, gamma, Interleukin-2 receptor subunit gamma, p64, SCIDX, SCIDX1, severe combined immunodeficiency |
| Gene Symbols | IL2RG |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.