Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Component C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15898420UL
Description
Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.Specifications
Complement Component C2 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43 | |
Rabbit | |
Affinity Purified | |
RUO | |
717 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C2 | |
Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction