Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Complement Component C2 Antibody, Novus Biologicals™

Complement Component C2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15898420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15898420 20 μL
NBP158984 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15898420 Supplier Novus Biologicals Supplier No. NBP15898420UL

Description

Rabbit Polyclonal Antibody

Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Complement Component C2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43
Gene Symbols C2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 717
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.