Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Component C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Complement Component C2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP158984
![]() |
Novus Biologicals
NBP158984 |
100 μL |
Each for $480.74
|
|
|||||
NBP15898420
![]() |
Novus Biologicals
NBP15898420UL |
20 μL | N/A | N/A | N/A | ||||
Description
Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.Specifications
| Complement Component C2 | |
| Polyclonal | |
| Rabbit | |
| C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43 | |
| C2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 717 | |
| Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title