Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Component C2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Complement Component C2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15898420
|
Novus Biologicals
NBP15898420UL |
20 μL |
Each for $152.22
|
|
NBP158984
|
Novus Biologicals
NBP158984 |
100 μL |
Each for $436.00
|
|
Description
Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.Specifications
Complement Component C2 | |
Polyclonal | |
Rabbit | |
C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43 | |
C2 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
717 | |
Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title