Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Component C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Complement Component C2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15898420
![]() |
Novus Biologicals
NBP15898420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP158984
![]() |
Novus Biologicals
NBP158984 |
100 μL |
Each for $487.50
|
|
|||||
Description
Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.Specifications
Complement Component C2 | |
Polyclonal | |
Rabbit | |
C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43 | |
C2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
717 | |
Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title