Complement Component C5aR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321274100UL

Catalog No. NB238293

Description

Complement Component C5aR1 Polyclonal antibody specifically detects Complement Component C5aR1 in Human samples. It is validated for Western Blot

Specifications

• Antigen: Complement Component C5aR1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml
• Gene Alias: C5A, C5a anaphylatoxin chemotactic receptor, C5aR, C5a-R, C5ARC5a anaphylatoxin receptor, C5R1C5a ligand, CD88, CD88 antigen, complement component 5 receptor 1, complement component 5 receptor 1 (C5a ligand), complement component 5a receptor 1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI
• Quantity: 100 μg
• Research Discipline: GPCR, Immunology, Innate Immunity
• Gene ID (Entrez): 728
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified