Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Component C5aR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | Complement Component C5aR1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Complement Component C5aR1 Polyclonal antibody specifically detects Complement Component C5aR1 in Human samples. It is validated for Western BlotSpecifications
Complement Component C5aR1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
GPCR, Immunology, Innate Immunity | |
PBS, pH 7.2, 40% glycerol | |
728 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
C5A, C5a anaphylatoxin chemotactic receptor, C5aR, C5a-R, C5ARC5a anaphylatoxin receptor, C5R1C5a ligand, CD88, CD88 antigen, complement component 5 receptor 1, complement component 5 receptor 1 (C5a ligand), complement component 5a receptor 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title