Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Factor D/Adipsin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17979320UL
Description
Complement Factor D/Adipsin Polyclonal specifically detects Complement Factor D/Adipsin in Human samples. It is validated for Western Blot.Specifications
Complement Factor D/Adipsin | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001919 | |
CFD | |
Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG. | |
Affinity Purified | |
RUO | |
1675 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Adipsin, ADNcomplement factor D, C3 convertase activator, complement factor D (adipsin), complement factor D preproprotein, D component of complement (adipsin), DF, EC 3.4.21, EC 3.4.21.46, PFD, Properdin factor DADIPSIN | |
Rabbit | |
24 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction