Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Complement Factor D/Adipsin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Complement Factor D/Adipsin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179793
|
Novus Biologicals
NBP179793 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP17979320
|
Novus Biologicals
NBP17979320UL |
20 μL | N/A | N/A | N/A | ||||
Description
Complement Factor D/Adipsin Polyclonal specifically detects Complement Factor D/Adipsin in Human samples. It is validated for Western Blot.Specifications
| Complement Factor D/Adipsin | |
| Polyclonal | |
| Rabbit | |
| NP_001919 | |
| 1675 | |
| Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Adipsin, ADNcomplement factor D, C3 convertase activator, complement factor D (adipsin), complement factor D preproprotein, D component of complement (adipsin), DF, EC 3.4.21, EC 3.4.21.46, PFD, Properdin factor DADIPSIN | |
| CFD | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title