Connexin 30/GJB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159193

Catalog No. NBP159193

Description

Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Connexin 30/GJB6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10804
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95452
• Gene Symbols: GJB6
• Immunogen: Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 92%; Rat: 92%; Goat: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG