Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Connexin 30/GJB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15919320UL

View more versions of this product

Catalog No. NBP15919320

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Connexin 30/GJB6
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	O95452
Gene Symbols	GJB6
Immunogen	Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS & 2% Sucrose. with No Preservative
Gene Alias	connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	10804
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Connexin 30/GJB6 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions