Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Connexin 30/GJB6 Antibody, Novus Biologicals™

Connexin 30/GJB6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15919320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15919320 20 μL
NBP159193 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15919320 Supplier Novus Biologicals Supplier No. NBP15919320UL

Description

Rabbit Polyclonal Antibody

Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Human samples. It is validated for Western Blot.

Specifications

Antigen Connexin 30/GJB6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. O95452
Gene Alias connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3
Gene Symbols GJB6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10804
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.