Connexin 30/GJB6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310836100UL

Catalog No. NB126573

Description

Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Connexin 30/GJB6
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Connexin 30/GJB6 (NP_001010937.1). Peptide sequence ISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMN
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10804
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.