Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 30/GJB6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Connexin 30/GJB6 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Mouse samples. It is validated for Western Blot.Specifications
| Connexin 30/GJB6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse Connexin 30/GJB6 (NP_001010937.1). Peptide sequence ISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMN | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 10804 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title