Connexin 31/GJB3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310553100UL

Catalog No. NB126007

Description

Connexin 31/GJB3 Polyclonal specifically detects Connexin 31/GJB3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Connexin 31/GJB3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: connexin 31, connexin-31, Cx31, CX31MGC102938, DFNA2, DFNA2B, EKV, erythrokeratodermia variabilis, FLJ22486, gap junction beta-3 protein, gap junction protein, beta 3, 31kD (connexin 31), gap junction protein, beta 3, 31kDa, gap junction protein, beta 3, 31kDa (connexin 31)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_032152). Peptide sequence MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2707
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.