Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 31/GJB3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Connexin 31/GJB3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Connexin 31/GJB3 Polyclonal specifically detects Connexin 31/GJB3 in Mouse samples. It is validated for Western Blot.Specifications
| Connexin 31/GJB3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| connexin 31, connexin-31, Cx31, CX31MGC102938, DFNA2, DFNA2B, EKV, erythrokeratodermia variabilis, FLJ22486, gap junction beta-3 protein, gap junction protein, beta 3, 31kD (connexin 31), gap junction protein, beta 3, 31kDa, gap junction protein, beta 3, 31kDa (connexin 31) | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_032152). Peptide sequence MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 2707 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title