Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 36/GJD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP159254
Description
Connexin 36/GJD2 Polyclonal specifically detects Connexin 36/GJD2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| Connexin 36/GJD2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Connexin-36, Cx36, CX36connexin 36, Gap junction alpha-9 protein, gap junction delta-2 protein, gap junction protein, alpha 9, 36kDa, gap junction protein, delta 2, 36kDa, GJA9connexin-36, MGC138315, MGC138319 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 57369 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:1000, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen 1:1000 | |
| Q9UKL4 | |
| GJD2 | |
| Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Chicken: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction