Connexin 37/GJA4 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP180512	100 μL

Catalog No. NBP180512 Supplier Novus Biologicals Supplier No. NBP180512

Description

Rabbit Polyclonal Antibody

Connexin 37/GJA4 Polyclonal antibody specifically detects Connexin 37/GJA4 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Connexin 37/GJA4
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: NP_032146
• Gene Alias: connexin 37, Connexin-37, Cx37, CX37connexin-37, gap junction alpha-4 protein, gap junction protein, alpha 4, 37kD (connexin 37), gap junction protein, alpha 4, 37kDa, gap junction protein, alpha 4, 37kDa (connexin 37)
• Gene Symbols: GJA4
• Host Species: Rabbit
• Immunogen: Synthetic peptide directed towards the N terminal of human Gja4. Peptide sequence RREERLRQKEGELRALPSKDLHVERALAAIEHQMAKISVAEDGRLRIRGA.
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2701
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Canine: 92%; Human: 92%; Sheep: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only