Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Connexin 43/GJA1 Antibody, Novus Biologicals™

Connexin 43/GJA1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238234 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238234 0.1 mL
NB396921 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238234 Supplier Novus Biologicals Supplier No. NBP238234
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Connexin 43/GJA1 Polyclonal specifically detects Connexin 43/GJA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Connexin 43/GJA1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P17302
Gene Alias connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3
Gene Symbols GJA1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2697
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.