Learn More
Description
Specifications
Specifications
| Antigen | Connexin 46/GJA3 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CAE3, connexin 46, connexin-46, Cx46, CX46gap junction alpha-3 protein, CZP3, gap junction protein, alpha 3, 46kD (connexin 46), gap junction protein, alpha 3, 46kDa, gap junction protein, alpha 3, 46kDa (connexin 46) |
| Gene Symbols | GJA3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
