Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Connexin 46/GJA3 Antibody, Novus Biologicals™

Connexin 46/GJA3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159197 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159197 100 μL
NBP15919720 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159197 Supplier Novus Biologicals Supplier No. NBP159197
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Connexin 46/GJA3 Polyclonal specifically detects Connexin 46/GJA3 in Human samples. It is validated for Western Blot.

Specifications

Antigen Connexin 46/GJA3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y6H8
Gene Alias CAE3, connexin 46, connexin-46, Cx46, CX46gap junction alpha-3 protein, CZP3, gap junction protein, alpha 3, 46kD (connexin 46), gap junction protein, alpha 3, 46kDa, gap junction protein, alpha 3, 46kDa (connexin 46)
Gene Symbols GJA3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GJA3(gap junction protein, alpha 3, 46kDa) The peptide sequence was selected from the N terminal of GJA3. Peptide sequence ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2700
Test Specificity Expected identity based on immunogen sequence: Castor bean: 100%; Camponotus floridanus: 91%; Butyrivibrio crossotus DSM 2876: 90%; Zebrafish: 90%; Rat: 90%; Florida lancelet: 84%; Aspergillus nidulans: 83%; Cellular slime mold: 83%; Aspergillus nidulans FGSC A4: 83%; Mouse: 83%; Human: 100%; Paramecium tetraurelia: 83%; Blood fluke: 81%; Blastocystis hominis: 81%; Candida lipolytica: 81%; Moniliophthora perniciosa FA553: 76%; Pyrenophora teres f. teres 0-1: 76%; Blackleg fungus: 76%; Marine diatom: 76%; Clostridiales bacterium 1_7_47FAA: 75%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Equine, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.