Connexin 58/GJA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP239088

Catalog No. NBP239088

Description

Connexin 58/GJA9 Polyclonal specifically detects Connexin 58/GJA9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Connexin 58/GJA9
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P57773
• Gene Symbols: GJA9
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LNGNQLMEKRETEGKDSKRNYYSRGHRSIPGVAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: connexin 59, connexin-58, Connexin-59, CX58, Cx59, CX59gap junction alpha 10, Gap junction alpha-10 protein, gap junction alpha-9 protein, gap junction protein, alpha 10, 59kDa, gap junction protein, alpha 9, 59kDa, GJA10, MGC50985
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81025
• Target Species: Human
• Isotype: IgG