COP9 signalosome complex subunit 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25858725UL

Catalog No. NB393377

Description

COP9 signalosome complex subunit 2 Polyclonal specifically detects COP9 signalosome complex subunit 2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: COP9 signalosome complex subunit 2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ALIEN, Alien homolog, COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), COP9 signalosome complex subunit 2, CSN2JAB1-containing signalosome subunit 2, SGN2TR-interacting protein 15, Signalosome subunit 2, thyroid receptor interacting protein 15, Thyroid receptor-interacting protein 15, TRIP15TRIP-15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: COPS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Neuronal Cell Markers, Neurotransmission, Signal Transduction
• Gene ID (Entrez): 9318
• Target Species: Human
• Isotype: IgG

For Research Use Only