COPG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157636

Catalog No. NBP157636

Description

COPG2 Polyclonal specifically detects COPG2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COPG2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2-COP, coat protein, nonclathrin, gamma-2-cop, coatomer protein complex, subunit gamma 2, coatomer subunit gamma-2, DKFZp761N09121, FLJ11781, Gamma-2-coat protein, gamma-2-COP
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Zebrafish: 100%; Xenopus: 92%; Bovine: 92%; Chicken: 92%; Pig: 92%; Rabbit: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UBF2
• Gene Symbols: COPG2
• Immunogen: Synthetic peptides corresponding to COPG2(coatomer protein complex, subunit gamma 2) The peptide sequence was selected from the N terminal of COPG2. Peptide sequence MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK.
• Quantity: 100 μL
• Research Discipline: Golgi Apparatus Markers, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 26958
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.