Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COPG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	COPG2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157636 View Documents View Product Certificates	Novus Biologicals NBP157636	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

COPG2 Polyclonal specifically detects COPG2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	COPG2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Golgi Apparatus Markers, Membrane Trafficking and Chaperones
Gene Alias	2-COP, coat protein, nonclathrin, gamma-2-cop, coatomer protein complex, subunit gamma 2, coatomer subunit gamma-2, DKFZp761N09121, FLJ11781, Gamma-2-coat protein, gamma-2-COP
Gene Symbols	COPG2
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9UBF2
Gene ID (Entrez)	26958
Immunogen	Synthetic peptides corresponding to COPG2(coatomer protein complex, subunit gamma 2) The peptide sequence was selected from the N terminal of COPG2. Peptide sequence MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

COPG2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents